Identification of the growth hormone‐releasing hormone analogue [Pro1, Val14]‐hGHRH with an incomplete C‐term amidation in a confiscated product
Simone Esposito, Koen Deventer, Peter Van Eenoo
Research Article — Peer-Reviewed Source
Original research published by Esposito et al. in Drug Testing and Analysis. Redistributed under Open Access — see publisher for license terms. MedTech Research Group provides these references for informational purposes. We do not conduct original research. All studies are the work of their respective authors and institutions.
In this work, a modified version of the 44 amino acid human growth hormone-releasing hormone (hGHRH(1-44)) containing an N-terminal proline extension, a valine residue in position 14, and a C-terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 ) has been identified in a confiscated product by liquid chromatography-high resolution mass spectrometry (LC-HRMS). Investigation of the product suggests also an incomplete C-term amidation. Similarly to other hGHRH analogues, available in black markets, this peptide can potentially be used as performance-enhancing drug due to its growth hormone releasing activity and therefore it should be considered as a prohibited substance in sport. Additionally, the presence of partially amidated molecule reveals the poor pharmaceutical quality of the preparation, an aspect which represents a big concern for public health as well.
Full text is available at the publisher.
Read at Publisher| DOI | 10.1002/dta.1730 |
| Journal | Drug Testing and Analysis |
| Year | 2014 |
| Authors | Simone Esposito, Koen Deventer, Peter Van Eenoo |
| License | Open Access — see publisher for license terms |
| Citations | 15 |